jagomart
digital resources
picture1_Research Pdf 24054 | S13071 016 1360 5


 303x       Filetype PDF       File size 2.81 MB       Source: parasitesandvectors.biomedcentral.com


File: Research Pdf 24054 | S13071 016 1360 5
miyoshi et al parasites vectors 2016 9 85 doi 10 1186 s13071 016 1360 5 research open access functional structure and antimicrobial activity of persulcatusin an antimicrobial peptide from the ...

icon picture PDF Filetype PDF | Posted on 31 Jul 2022 | 4 years ago
Partial capture of text on file.
                Miyoshi et al. Parasites & Vectors  (2016) 9:85 
                DOI 10.1186/s13071-016-1360-5
                 RESEARCH                                                                                                   Open Access
                Functional structure and antimicrobial
                activity of persulcatusin, an antimicrobial
                peptide from the hard tick Ixodes
                persulcatus
                                   1                2                     2                 1                   1             1
                Naruhide Miyoshi , Takeshi Saito , Tadahiro Ohmura , Kengo Kuroda , Kazumasa Suita , Kohei Ihara
                and Emiko Isogai1*
                 Abstract
                 Background: Antimicrobial peptides (AMPs) are considered promising candidates for the development of novel
                 anti-infective agents. In arthropods such as ticks, AMPs form the first line of defense against pathogens in the
                 innate immune response. Persulcatusin (IP) was found in the Ixodes persulcatus midgut, and its amino acid
                 sequence was reported. However, the complete structure of IP has not been identified. We evaluated the
                 relation between structural features and antimicrobial activity of IP, and its potential as a new anti-methicillin-
                 resistant Staphylococcus aureus (MRSA) agent.
                 Methods: The structure of IP was predicted using homology modeling and molecular dynamics. IP and other
                 tick AMPs were synthesized using a solid-phase method and purified by high-performance liquid chromatography.
                 Methicillin-susceptible S. aureus (MSSA) and MRSA were used for the minimum inhibitory concentration (MIC) test and
                 short-time killing assay of IP and other tick peptides. The influence of IP on mammalian fibroblasts and colon epithelial
                 cells and each cell DNA and its hemolytic activity towards human erythrocytes were also examined.
                 Results: In the predicted IP structure, the structure with an S-S bond was more stable than that without an S-S bond.
                 The MIC after 24 h of incubation with IP was 0.156–1.25 μg/mL for MSSA and 0.625–2.5 μg/mL for MRSA. Compared
                 with the mammalian antimicrobial peptide and other tick peptides, IP was highly effective against MRSA. Moreover, IP
                 showed a dose-dependent bactericidal effect on both MSSA and MRSA after 1 h of incubation. IP had no observable
                 effect on mammalian cell growth or morphology, on each cell DNA and on human erythrocytes.
                 Conclusions: We predicted the three-dimensional structure of IP and found that the structural integrity was maintained
                 by three S-S bonds, which were energetically important for the stability and for forming α helix and β sheet. IP has
                 cationic and amphipathic properties, which might be related to its antimicrobial activity. Furthermore, the antimicrobial
                 activity of IP against MRSA was stronger than that of other antimicrobial peptides without apparent damage
                 to mammalian and human cells, demonstrating its possible application as a new anti-MRSA medicine.
                 Keywords: Tick, Antimicrobial peptide, Persulcatusin, S-S bond, Methicillin-resistant Staphylococcus aureus
                * Correspondence: homeiso2006@yahoo.co.jp
                1
                Department of Animal Microbiology, Graduate School of Agricultural
                Science, Tohoku University, 1-1 Tsutsumidori Amamiya-machi, Aoba-ku,
                Sendai, Miyagi 981-8555, Japan
                Full list of author information is available at the end of the article
                                                 ©2016 Miyoshi et al. Open Access This article is distributed under the terms of the Creative Commons Attribution 4.0
                                                 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and
                                                 reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to
                                                 the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver
                                                 (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
               Miyoshi et al. Parasites & Vectors  (2016) 9:85                                                                     Page 2 of 11
               Background                                                         Hundreds of AMPs have been isolated and character-
               Multidrug-resistant bacteria are a severe threat to public       ized to understand their mode of action, but many
               health. Conventional antibiotics are becoming increas-           AMPs have limited use as therapeutics, owing to their
               ingly ineffective because of such resistance, and it is im-      cytotoxicity against mammalian cells [19–21]. IP may
               perative   to   find   new antibacterial      strategies  [1].   have the same problem. However, the first symptom of
               Antimicrobial peptides (AMPs) are an integral part of            Lyme disease is reported to be an erythema migrans, a
               the innate immune system of all living organisms and             type of inflammation of the skin [22], which is affected
               are considered promising candidates for the develop-             by molecules present in tick saliva [23]. The candidate
               ment of novel anti-infective agents [2]. These molecules         molecules that cause this inflammation include the tick
               have a broad antimicrobial activity spectrum, various            AMPbecause AMPs have an immunomodulation ability
               modes of action, and decreased incidence of resistance           [24]. To examine these effects, the ability of IP to affect
               development [3, 4]. A major AMP family is the defensin           mammalian cells and its hemolytic activity against hu-
               family found in various organisms including plants, ver-         manerythrocytes was tested.
               tebrates, and invertebrates [5]. AMPs of arthropods,               I. persulcatus have feeding activities. Our study group
               who have a powerful innate immune response, are in-              found that S. aureus cannot be isolated from I. persulcatus
               cluded in this family [6].                                       during feeding [16]. This is thought to be caused by the
                 Ticks are external hematophagous parasites that live           antimicrobial activity of IP [13, 18]. S. aureus is potentially
               on the blood of mammals, birds, and, occasionally, rep-          pathogenic and can adapt rapidly to the selective pressure
               tiles and amphibians. A handful of ticks are vectors of          of antibiotics [25]. In particular, methicillin-resistant S.
               many diseases that affect both humans and other ani-             aureus (MRSA) infections have become major public
               mals [7]. Ixodes persulcatus is a predominant tick species       health   concern.   Since   the   late  1990s,   community-
               that spreads a wide array of serious human and animal            associated MRSA has emerged as a principal cause of skin
               pathogens, including Borrelia garinii, which causes Lyme         and soft-tissue epidemics worldwide [26, 27]. As the
               disease. In Japan, Lyme disease in humans is due to in-          Journal of the American Medical Association reported
               fection with B. garinii or B. afzelii, which are specifically    in 2007, there were an estimated 94,360 cases of
               transmitted by I. persulcatus [8]. Despite the ability of        MRSA infections in the United States in 2005 [28].
               ticks to harbor and transmit pathogens, their immune               In this study, we predicted the three-dimensional
               system offers effective mechanisms against pathogenic            structure of IP by homology modeling and synthesized
               microorganisms in the event of their permeation into             IP and other tick AMPs to evaluate their antimicrobial
               the tick body [9].                                               activity against MRSA. In addition, we examined the
                 In ticks, AMPs form the first line of defense against          toxicity of IP toward mammalian cells. Throughout this
               pathogens in the innate immune response [10]. Tick               study, we evaluated the relation between structural fea-
               AMPs have been detected in several tissues, such as the          ture and antimicrobial activity of IP, and the potential of
               midgut and salivary glands, and can be inoculated into           IP as a new anti-MRSA agent.
               host bodies during blood meals [11, 12]. Persulcatusin
               (IP), a tick AMP in the I. persulcatus, was found in the
               tick midgut and its amino acid sequence was reported             Methods
               [13]. Furthermore, this AMP has antimicrobial activity           Homology modeling
               against gram-positive bacteria such as Staphylococcus            The amino acid sequence of tick AMP IP was GFG
               aureus [13]. Most AMPs from insects and arthropods               CPFNQGACHRHCRSIGRRGGYCAGLFKQTCTCYSR
               conserve a characteristic motif of six cysteines, which          (AB469201). The template structure was selected by
               form three disulfide bonds [14, 15]. Tick AMPs are well          searching PubMed for structures including >1 α
               known and the most widely characterized among anti-              helix and >1 β sheet. We superposed the structures
               microbial molecules [9, 11, 12, 16, 17]. Similar to other        and classified clusters for the template-structure
               tick AMPs, IP contains six cysteine residues that may            candidates     by using three-dimensional structure
               form S-S bonds, but the structure of IP has not been             multiple alignments. We assumed each cluster to be
               identified. Our research group previously investigated           a template. Sequences were aligned by manual cor-
               the relation between the antimicrobial activity of IP and        rection using the results of three-dimensional struc-
               its three-dimensional and primary structure, and found           ture    multiple     alignments.     We produced five
               that IP with a three-dimensional structure was more ef-          structures by the Build Homology Model protocol
               fective to gram-positive bacteria compared to that with a        of Discovery Studio® 2.5 (Dassault Systèmes BIO-
               primary structure [18]. Therefore, to prove the import-          VIA, San Diego) and selected one homology model
               ance of the three-dimensional structure of tick, it is im-       from each template structure by applying the fol-
               portant to perform prediction of IP structure.                   lowing standards sequentially;
                   Miyoshi et al. Parasites & Vectors  (2016) 9:85                                                                                            Page 3 of 11
                     (1)Probability density function (PDF) Total Energy,                         the tick AMPs, and for mammalian AMP, a bovine
                         PDF Physical Energy, and Discrete optimized protein                     myeloid antimicrobial peptide (BMAP28) was used.
                         energy (DOPE) Score was superior to that of other                       Their sequences have been reported [11, 29–31].
                         structures
                     (2)There were fewer residues outside the domain                             Bacterial strain and culture conditions
                         compared to other structures in the Ramachandran                        In the growth inhibition test, we used 9 clinical strains
                         Plot.                                                                   of methicillin-susceptible S. aureus (MSSA) and 9 clin-
                     (3)High rank of the Verify Score provided in Verify                         ical strains of MRSA from patients in Jichi Medical Uni-
                         Protein (Profile-3D)                                                    versity Hospital, using these strains in past report [31].
                                                                                                 The bacteria were grown in Trypto Soya (TS; Nissui,
                     From these homology models, we built each structure                         Tokyo, Japan) broth for 18–19 h at 37 °C.
                   with or without an SS combination and optimized hydro-
                   gen atoms by using the Chemistry at HARvard Macro-                            Growth inhibition test
                   molecular Mechanics (CHARMm) force field. We used                             The optical density at 660 nm (OD660) of pre-cultured
                   the Minimization protocol for structure optimization.                         bacteria was measured using an Ubest-35 (JASCO Cor-
                                                                                                 poration, Tokyo, Japan). The adjustment for an OD660 of
                   Molecular dynamics                                                            0.5 was conducted by adding TS broth. The bacteria
                                                                                                                                                                 4
                   For each initial structure obtained by homology model-                        were diluted to a final concentration of 1–5×10 colony
                   ing, we performed a fixed temperature simulation of the                       forming units (CFUs) /mL with TS broth, after which
                   Generalized Born with a simple SWitching (GBSW) Im-                           50 μL of bacterial suspension and 50 μL of peptide solu-
                   plicit Solvent Model in 10 nsec at 300 K by using the                         tion were mixed together in a 96-well plate. The peptide
                   Standard Dynamics Cascade and sampled the structure                           solution was prepared by two-fold dilution in TS broth,
                   every 1 psec. The representative structure among the                          while the IP solution was prepared to final peptide con-
                   sampled structure was selected using the following                            centrations of 40, 20, 10, 5, 2.5, 1.25, 0.625, 0.313, 0.157,
                   protocol:                                                                     and 0.079 μg/mL. Each mixture of bacteria and peptide
                                                                                                 solution was incubated at 37 °C. The OD660 of the cell
                     (1)Sort sampling structures by using a Root mean                            suspension was measured after 20–24 h incubation by
                         square deviation (RMSD) score from the initial
                         structure, distribute it into 1000 parts, and build 10                  Table 1 Selected 20 structures from Protein Data Bank (PDB)
                         structure ensembles                                                     Accession numbers      Species                        Category     Method
                     (2)Calculate the intersection RMSD in each group and                        1AYJ                   Raphanus sativus Var. niger    Plant        NMR
                         carry out segmented hierarchical clustering by using
                         the distance matrix                                                     1BK8                   Aesculus hippocastanum         Plant        NMR
                     (3)Select the representative structure by using a                           1JKZ                   Pisum sativum                  Plant        NMR
                         threshold based on a dendrogram of the clustering                       1MR4                   Nicotiana tabacum              Plant        NMR
                     (4)Optimize by energy minimization                                          1N4N                   Petunia x hybrida              Plant        NMR
                                                                                                 1TI5                   Vigna radiata                  Plant        NMR
                     In addition, we selected the structure with the lowest                      1UGL                   Brassica rapa                  Plant        NMR
                   potential energy in each cluster, minimized its energy,
                   and estimated the final structure. All these calculations                     2GL1                   Vigna radiata                  Plant        NMR
                   were performed using Discovery Studio 2.5®.                                   1L4V                   Sarcophaga peregrina           Insect       NMR
                                                                                                 1MM0                   Pseudacanthotermes spiniger    Insect       NMR
                   Peptide synthesis and purification                                            1OZZ                   Archaeoprepona demophon        Insect       NMR
                   Tick and mammalian peptides were synthesized by the                           2E3E                   Anopheles gambiae              Insect       NMR
                   solid-phase method, as previously described [16]. The                         2E3F                   Anopheles gambiae              Insect       NMR
                   peptides were purified by reverse-phase high-performance
                   liquid chromatography (Model LC-8A; Shimadzu Corpor-                          2E3G                   Anopheles gambiae              Insect       NMR
                   ation, Kyoto, Japan) on a YMC-A 302 column. The final                         2NY8                   Anopheles gambiae              Insect       NMR
                   products were confirmed by electrospray ionization mass                       2NY9                   Anopheles gambiae              Insect       NMR
                   spectrometry and were supplied as trifluoroacetates. This                     2NZ3                   Anopheles gambiae              Insect       NMR
                   trifluoroacetate form of the peptides was conserved                           1FJN                   Mediterranean mussel           Bivalve      NMR
                   by suspending in Hanks’ Balanced Salt Solution                                2B68                   Crassostrea gigas              Bivalve      NMR
                   (HBSS; GIBCO, Grand Island, NY, USA) at pH 7.4
                   and stored at −20 °C. IR, HAE, and OMBAC were                                 3E7R                   Pseudoplectania nigrella       Fungi        X-ray
        Miyoshi et al. Parasites & Vectors  (2016) 9:85        Page 4 of 11
        Fig. 1 Sequence alignment of each cluster. By superposing the 20 structures with three-dimensional structure alignment and classifying cluster
        with the similarity, the 5 clusters were made by 16 structures. The clusters are cluster 1 (a), cluster 2 (b), cluster 3 (c), cluster 4 (d), and cluster 5
        (e). Other 4 structures are Orphan. AB469201 was the amino acid sequence of IP and other accession numbers are described in Table 1
The words contained in this file might help you see if this file matches what you are looking for:

...Miyoshi et al parasites vectors doi s research open access functional structure and antimicrobial activity of persulcatusin an peptide from the hard tick ixodes persulcatus naruhide takeshi saito tadahiro ohmura kengo kuroda kazumasa suita kohei ihara emiko isogai abstract background peptides amps are considered promising candidates for development novel anti infective agents in arthropods such as ticks form first line defense against pathogens innate immune response ip was found midgut its amino acid sequence reported however complete has not been identified we evaluated relation between structural features potential a new methicillin resistant staphylococcus aureus mrsa agent methods predicted using homology modeling molecular dynamics other were synthesized solid phase method purified by high performance liquid chromatography susceptible mssa used minimum inhibitory concentration mic test short time killing assay influence on mammalian fibroblasts colon epithelial cells each cell dn...

no reviews yet
Please Login to review.